PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G1579
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 368aa    MW: 42346 Da    PI: 6.8438
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G1579genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.16.3e-2555136286
     trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  W ++e++ Li +r+em+ r++++k++k+lWe++s+ mr++gf rsp++C++kw+nl k++kk k+ +++  s+s+ ++ y++++e
  Gh_D01G1579  55 WVQDETRSLIGFRKEMDGRFNTSKSNKHLWEKISAMMRKKGFDRSPTMCTDKWRNLLKEFKKAKHPDRG--SGSV-KMCYYKEIE 136
                  *****************************************************************9998..5666.566999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.3E-445116IPR009057Homeodomain-like
PROSITE profilePS500908.07247111IPR017877Myb-like domain
SMARTSM007170.001351113IPR001005SANT/Myb domain
CDDcd122037.96E-2855118No hitNo description
PfamPF138371.9E-1955138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MARDMIIEVT TNGGFPDHLH HYHPHSLQQQ QQMILGESSG DDPEVKAPKK RAEIWVQDET  60
RSLIGFRKEM DGRFNTSKSN KHLWEKISAM MRKKGFDRSP TMCTDKWRNL LKEFKKAKHP  120
DRGSGSVKMC YYKEIEEILR ERTKKSYKSP TSPPKLDSFM HFSDKGLCFE DTSITFGPLE  180
GMLLLLLPSG RPALNIEQGL DYDGHPLAIT TASGVPPWNW RETPGNGGDC LPYGGRVITV  240
KYGDYTQRIG IDGTTEAIRE AIKSAFRLRT KRAFWLEDED HIIRSLDREM PLGNYKLHLD  300
EGLAVKVCLY DESDHIPVHT EEKIFYTEDD YREYLVLRGY AGLREIDGYR NIDSMDDLQT  360
NTIYRGVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A8e-4649134186DNA binding protein GT-1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467487.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X1
SwissprotQ9FX531e-177TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0B0N3620.0A0A0B0N362_G
STRINGPOPTR_0008s17980.10.0(Populus trichocarpa)
STRINGGLYMA11G37390.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.11e-164Trihelix family protein